Cp Dp

LH CPDP-2T3T-1 OSRAM Opto Semiconductors High Power LEDs - Single Color Hyper Red, 660nm datasheet, inventory, & pricing.

BLAST >sp Q56686 CPDP_ALIFS 3',5'-cyclic-nucleotide phosphodiesterase OS=Aliivibrio fischeri OX=668 GN=cpdP PE=3 SV=1 MFKNKLAVLFTCLSVFSFSAQSGSFDTVTLGSKGGIQDGNLTAFLIKSEADSNFVMLDAG SVVNGLIVSEQKGAFKDITVPDSSPYTKVGYLLKDRIKGYFISHAHLDHVAGLIISSPDD SKKPIYGLAATNKDLMKNYFNWSAWPNFGNKGEGFKLNKYNYVDLQPGVWSPVAETTMSV VSLPLSHSGGQSTVFILKDSEGDVFAYFGDTGPDEVEKSSAMRTAWSVLAPFVKQGKLKG IIIEVSFTNETPDKSLFGHLTPNWLVKELSVLEDMNGKGSLKDLNVAISHIKYSLKNSED PKVIIKKQLVEVNDLGVNFIFPEQGDSLQF Align Format Add to basket Added to basket History. Annotation score: Annotation score:2 out of 5 The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score cannot be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.More. -Protein inferred from homology i This indicates the type of evidence that supports the existence of the protein.

Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.More. This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.More.Names & Taxonomy i This subsection of the Names and taxonomy section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.More.Protein names i. Name: cpdP This subsection of the Names and taxonomy section provides information on the name(s) of the organism that is the source of the protein sequence.More.Organism i This subsection of the Names and taxonomy section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.More.Taxonomic identifier i [] This subsection of the Names and taxonomy section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.More.Taxonomic lineage i › › › › › ›. This section describes post-translational modifications (PTMs) and/or processing events.More.PTM / Processing i Molecule processing Feature key Position(s) Description Actions Graphical view Length This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.More.Signal peptide i Sequence analysis 22 This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.More.Chain i PRO_ 3',5'-cyclic-nucleotide phosphodiesterase 308.

Do vstrechi v gorodke. Do vstrechi v Gorodke (Russkiĭ proekt) (Russian Edition) [I͡U︡riĭ Stoi͡a︡nov] on Amazon.com. *FREE* shipping on qualifying offers. Do vstrechi v 'Gorodke' by I͡Uriĭ Stoi͡anov Published 1999 by Neva, OLMA-PRESS in Sankt-Peterburg, Moskva.

Belongs to the. This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including length and molecular weight.More.Sequence i This subsection of the Sequence section indicates if the canonical sequence displayed by default in the entry is complete or not.More.Sequence status i: Complete. This subsection of the Sequence section indicates if the canonical sequence displayed by default in the entry is in its mature form or if it represents the precursor.More.Sequence processing i: The displayed sequence is further processed into a mature form. The checksum is a form of redundancy check that is calculated from the sequence.

It is useful for tracking sequence updates. It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.

However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs). The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x64 + x4 + x3 + x + 1.

The algorithm is described in the ISO 3309 standard. Press W.H., Flannery B.P., Teukolsky S.A. And Vetterling W.T. Cyclic redundancy and other checksums Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)) Checksum: iB87127EE2CE213D4. This section provides general information on the entry.More.Entry information i This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier.

Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.More.Entry name i CPDP_ALIFS This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.More.Accession i Primary (citable) accession number: Q56686 This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the canonical sequence are also displayed.More.Entry history i Integrated into UniProtKB/Swiss-Prot: May 30, 2000 Last sequence update: November 1, 1996 Last modified: December 5, 2018 This is version 72 of the entry and version 1 of the sequence. This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (reviewed) or to the computer-annotated TrEMBL section (unreviewed).More.Entry status i Reviewed (UniProtKB/Swiss-Prot) Annotation program.